MAOB antibody (70R-6477)

Rabbit polyclonal MAOB antibody raised against the N terminal of MAOB

Synonyms Polyclonal MAOB antibody, Anti-MAOB antibody, MGC26382 antibody, Monoamine Oxidase B antibody
Specificity MAOB antibody was raised against the N terminal of MAOB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAOB antibody was raised using the N terminal of MAOB corresponding to a region with amino acids RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV
Assay Information MAOB Blocking Peptide, catalog no. 33R-7858, is also available for use as a blocking control in assays to test for specificity of this MAOB antibody

Images

Immunohistochemical staining using MAOB antibody (70R-6477)

Liver

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAOB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MAOB antibody (70R-6477) | Liver
  • Western blot analysis using MAOB antibody (70R-6477) | Recommended MAOB Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors