Map2k5 Blocking Peptide (33R-10402)

A synthetic peptide for use as a blocking control in assays to test for specificity of Map2k5 antibody, catalog no. 70R-8801

Synonyms Map2k5 control peptide, Map2k5 antibody Blocking Peptide, Anti-Map2k5 Blocking Peptide, mitogen-activated protein kinase kinase 5 Blocking Peptide, AI324775 Blocking Peptide, AI428457 Blocking Peptide, MEK5 Blocking Peptide, Mapkk5 Blocking Peptide, Prkmk5 Blocking Peptide, Map2k5, Mapk5-2, Mapk5 2, Mapk5-2 Blocking Peptide, Mapk5 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SNSLKKSSAELRKILANGQMNEQDIRYRDTLGHGNGGTVYKAHHVPSGKI
Molecular Weight 50 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Map2k5 acts as a scaffold for the formation of a ternary MAP3K2/MAP3K3-MAP3K5-MAPK7 signaling complex. Activation of this pathway appear to play a critical role in protecting cells from stress-induced apopotosis, neuronal survival and cardiac development and angiogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors