MAP3K1 antibody (70R-2358)

Rabbit polyclonal MAP3K1 antibody raised against the C terminal of MAP3K1

Synonyms Polyclonal MAP3K1 antibody, Anti-MAP3K1 antibody, MAP 3 antibody, MAP3, MAP-3, MAPKKK1 antibody, MEKK antibody, MEKK1 antibody, MAP-3 antibody, MAP 3, Mitogen-Activated Protein Kinase 1 antibody
Specificity MAP3K1 antibody was raised against the C terminal of MAP3K1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAP3K1 antibody was raised using the C terminal of MAP3K1 corresponding to a region with amino acids LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
Assay Information MAP3K1 Blocking Peptide, catalog no. 33R-4960, is also available for use as a blocking control in assays to test for specificity of this MAP3K1 antibody


Western Blot analysis using MAP3K1 antibody (70R-2358)

MAP3K1 antibody (70R-2358) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 164 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP3K1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin and many growth factors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAP3K1 antibody (70R-2358) | MAP3K1 antibody (70R-2358) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors