MAP3K14 antibody (70R-3485)

Rabbit polyclonal MAP3K14 antibody raised against the N terminal of MAP3K14

Synonyms Polyclonal MAP3K14 antibody, Anti-MAP3K14 antibody, FTDCR1B antibody, MAP3, MAP-3 antibody, MAP-3, HS antibody, MAP 3 antibody, MAP 3, Mitogen-Activated Protein Kinase 14 antibody, HSNIK antibody, NIK antibody
Specificity MAP3K14 antibody was raised against the N terminal of MAP3K14
Cross Reactivity Human
Applications WB
Immunogen MAP3K14 antibody was raised using the N terminal of MAP3K14 corresponding to a region with amino acids SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
Assay Information MAP3K14 Blocking Peptide, catalog no. 33R-8382, is also available for use as a blocking control in assays to test for specificity of this MAP3K14 antibody

Images

Western Blot analysis using MAP3K14 antibody (70R-3485)

MAP3K14 antibody (70R-3485) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 104 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP3K14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes mitogen-activated protein kinase kinase kinase 14, which is a serine/threonine protein-kinase. This kinase binds to TRAF2 and stimulates NF-kappaB activity. It shares sequence similarity with several other MAPKK kinases. It participates in an NF-kappaB-inducing signalling cascade common to receptors of the tumour-necrosis/nerve-growth factor (TNF/NGF) family and to the interleukin-1 type-I receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAP3K14 antibody (70R-3485) | MAP3K14 antibody (70R-3485) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors