MAP3K2 antibody (70R-5767)

Rabbit polyclonal MAP3K2 antibody raised against the N terminal of MAP3K2

Synonyms Polyclonal MAP3K2 antibody, Anti-MAP3K2 antibody, MAP3, MEKK2B antibody, MEKK2 antibody, Mitogen-Activated Protein Kinase 2 antibody, MAP 3, MAP-3, MAP-3 antibody, MAP 3 antibody
Specificity MAP3K2 antibody was raised against the N terminal of MAP3K2
Cross Reactivity Human
Applications WB
Immunogen MAP3K2 antibody was raised using the N terminal of MAP3K2 corresponding to a region with amino acids AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE
Assay Information MAP3K2 Blocking Peptide, catalog no. 33R-1147, is also available for use as a blocking control in assays to test for specificity of this MAP3K2 antibody

Images

Western Blot analysis using MAP3K2 antibody (70R-5767)

MAP3K2 antibody (70R-5767) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP3K2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAP3K2 antibody (70R-5767) | MAP3K2 antibody (70R-5767) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors