MAP3K7IP1 antibody (70R-5775)

Rabbit polyclonal MAP3K7IP1 antibody raised against the N terminal of MAP3K7IP1

Synonyms Polyclonal MAP3K7IP1 antibody, Anti-MAP3K7IP1 antibody, MAP 3 antibody, Mitogen-Activated Protein Kinase 7 Interacting Protein 1 antibody, MAP-3, MAP 3, MGC57664 antibody, MAP3, 3'-Tab1 antibody, MAP-3 antibody, TAB1 antibody
Specificity MAP3K7IP1 antibody was raised against the N terminal of MAP3K7IP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAP3K7IP1 antibody was raised using the N terminal of MAP3K7IP1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE
Assay Information MAP3K7IP1 Blocking Peptide, catalog no. 33R-5608, is also available for use as a blocking control in assays to test for specificity of this MAP3K7IP1 antibody

Images

Western Blot analysis using MAP3K7IP1 antibody (70R-5775)

MAP3K7IP1 antibody (70R-5775) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP3K7IP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene was identified as a regulator of the MAP kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAP3K7IP1 antibody (70R-5775) | MAP3K7IP1 antibody (70R-5775) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors