MAP4K2 antibody (70R-5784)

Rabbit polyclonal MAP4K2 antibody raised against the N terminal of MAP4K2

Synonyms Polyclonal MAP4K2 antibody, Anti-MAP4K2 antibody, MAP 4 antibody, MAP4, MAP 4, MAP-4 antibody, Mitogen-Activated Protein Kinase 2 antibody, MAP-4, GCK antibody, BL44 antibody, RAB8IP antibody
Specificity MAP4K2 antibody was raised against the N terminal of MAP4K2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAP4K2 antibody was raised using the N terminal of MAP4K2 corresponding to a region with amino acids HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE
Assay Information MAP4K2 Blocking Peptide, catalog no. 33R-3778, is also available for use as a blocking control in assays to test for specificity of this MAP4K2 antibody


Western Blot analysis using MAP4K2 antibody (70R-5784)

MAP4K2 antibody (70R-5784) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP4K2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAP4K2 antibody (70R-5784) | MAP4K2 antibody (70R-5784) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors