MAP4K4 antibody (70R-5785)

Rabbit polyclonal MAP4K4 antibody raised against the N terminal of MAP4K4

Synonyms Polyclonal MAP4K4 antibody, Anti-MAP4K4 antibody, FLJ10410 antibody, HGK antibody, Mitogen-Activated Protein Kinase 4 antibody, MAP-4, MAP-4 antibody, MAP 4, NIK antibody, MAP 4 antibody, FLJ90111 antibody, KIAA0687 antibody, MAP4, FLJ20373 antibody, FLH21957 antibody
Specificity MAP4K4 antibody was raised against the N terminal of MAP4K4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAP4K4 antibody was raised using the N terminal of MAP4K4 corresponding to a region with amino acids PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ
Assay Information MAP4K4 Blocking Peptide, catalog no. 33R-7076, is also available for use as a blocking control in assays to test for specificity of this MAP4K4 antibody


Immunohistochemical staining using MAP4K4 antibody (70R-5785)



Host Rabbit
Method of Purification Affinity purified
Molecular Weight 133 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP4K4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MAP4K4 antibody (70R-5785) | Liver
  • Western blot analysis using MAP4K4 antibody (70R-5785) | Recommended MAP4K4 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors