MAPK12 antibody (70R-5682)

Rabbit polyclonal MAPK12 antibody raised against the N terminal of MAPK12

Synonyms Polyclonal MAPK12 antibody, Anti-MAPK12 antibody, Mitogen-Activated Protein Kinase 12 antibody, SAPK3 antibody, SAPK-3 antibody, ERK6 antibody, P38GAMMA antibody, ERK3 antibody, PRKM12 antibody
Specificity MAPK12 antibody was raised against the N terminal of MAPK12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE
Assay Information MAPK12 Blocking Peptide, catalog no. 33R-8447, is also available for use as a blocking control in assays to test for specificity of this MAPK12 antibody

Images

Western Blot analysis using MAPK12 antibody (70R-5682)

MAPK12 antibody (70R-5682) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAPK12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAPK12 antibody (70R-5682) | MAPK12 antibody (70R-5682) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors