MAPK13 antibody (70R-5668)

Rabbit polyclonal MAPK13 antibody raised against the middle region of MAPK13

Synonyms Polyclonal MAPK13 antibody, Anti-MAPK13 antibody, Mitogen-Activated Protein Kinase 13 antibody, p38delta antibody, PRKM13 antibody, SAPK4 antibody, MGC99536 antibody
Specificity MAPK13 antibody was raised against the middle region of MAPK13
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD
Assay Information MAPK13 Blocking Peptide, catalog no. 33R-4558, is also available for use as a blocking control in assays to test for specificity of this MAPK13 antibody

Images

Western Blot analysis using MAPK13 antibody (70R-5668)

MAPK13 antibody (70R-5668) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAPK13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation and transcription.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAPK13 antibody (70R-5668) | MAPK13 antibody (70R-5668) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors