MAPK3 antibody (70R-5574)

Rabbit polyclonal MAPK3 antibody raised against the middle region of MAPK3

Synonyms Polyclonal MAPK3 antibody, Anti-MAPK3 antibody, PRKM3 antibody, HUMKER1A antibody, P44ERK1 antibody, Mitogen-Activated Protein Kinase 3 antibody, ERK1 antibody, MGC20180 antibody, P44MAPK antibody, HS44KDAP antibody
Specificity MAPK3 antibody was raised against the middle region of MAPK3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids EALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQ
Assay Information MAPK3 Blocking Peptide, catalog no. 33R-2265, is also available for use as a blocking control in assays to test for specificity of this MAPK3 antibody


Western Blot analysis using MAPK3 antibody (70R-5574)

MAPK3 antibody (70R-5574) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAPK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation and differentiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAPK3 antibody (70R-5574) | MAPK3 antibody (70R-5574) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors