MAPK4 antibody (70R-5509)

Rabbit polyclonal MAPK4 antibody raised against the middle region of MAPK4

Synonyms Polyclonal MAPK4 antibody, Anti-MAPK4 antibody, Mitogen-Activated Protein Kinase 4 antibody, PRKM4 antibody, Erk4 antibody, ERK3 antibody, p63MAPK antibody
Specificity MAPK4 antibody was raised against the middle region of MAPK4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MAPK4 antibody was raised using the middle region of MAPK4 corresponding to a region with amino acids DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD
Assay Information MAPK4 Blocking Peptide, catalog no. 33R-1930, is also available for use as a blocking control in assays to test for specificity of this MAPK4 antibody


Western Blot analysis using MAPK4 antibody (70R-5509)

MAPK4 antibody (70R-5509) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAPK4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targets.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MAPK4 antibody (70R-5509) | MAPK4 antibody (70R-5509) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors