MAPT antibody (70R-6020)

Rabbit polyclonal MAPT antibody raised against the middle region of MAPT

Synonyms Polyclonal MAPT antibody, Anti-MAPT antibody, MSTD antibody, MGC138549 antibody, PPND antibody, Microtubule-Associated Protein Tau antibody, MTBT2 antibody, FTDP-17 antibody, DDPAC antibody, FLJ31424 antibody, MTBT1 antibody, MAPTL antibody, TAU antibody
Specificity MAPT antibody was raised against the middle region of MAPT
Cross Reactivity Human
Applications WB
Immunogen MAPT antibody was raised using the middle region of MAPT corresponding to a region with amino acids NAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLAD
Assay Information MAPT Blocking Peptide, catalog no. 33R-6638, is also available for use as a blocking control in assays to test for specificity of this MAPT antibody

Images

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAPT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Product Use Purified polyclonal MAPT antibody specific for Human MAPT for use in Western Blot.
Biological Significance MAPT (TAU protein) is a highly soluble microtubule-associated protein (MAP). In humans, these proteins are found mostly in neurons compared to non-neuronal cells. One of tau's main functions is to modulate the stability of axonal microtubules. interact with tubulin to stabilize microtubules and promote tubulin assembly into microtubules. MAPT (Tau) has two ways of controlling microtubule stability: isoforms and phosphorylation. MAPT may be involved in the establishment and maintenance of neuronal polarity.
Expression MAPT is primarily expressed in neurons. MAPT/TAU proteins are abundant in neurons of the central nervous system and are less common elsewhere, but are also expressed at very low levels in CNS astrocytes and oligodendrocytes.
Implications in Disease Hyperphosphorylation of the tau protein (tau inclusions, pTau) can result in the self-assembly of tangles of paired helical filaments and straight filaments, which are involved in the pathogenesis of Alzheimer's disease, frontotemporal dementia, and other tauopathies. In other neurodegenerative diseases, the deposition of aggregates enriched in certain tau isoforms has been reported. Defects in MAPT are a cause of Pick disease of the brain, a rare form of dementia pathologically defined by severe atrophy, neuronal loss and gliosis.
Sequence Information MAPT is composed of 758 amino acids with a molecular weight of 78928 Da. MAPT contains 4 Tau/MAP repeats at positions 574 – 574, 637 – 637, 686 – 686, and 706 – 706.
Post-Translational Modifications Phosphorylation of MAPT occurs at serine and threonine residues in S-P or T-P motifs by proline-directed protein kinases (PDPK1: CDK1, CDK5, GSK3, MAPK) (only 2-3 sites per protein in interphase, seven-fold increase in mitosis, and in the form associated with paired helical filaments (PHF-tau)), and at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules, and their disassembly. MAPT is O-glycosylated. Glycosylation occurs at Lys87, Lys383, Lys467, Lys480, Lys491, Ser525, Lys542, Lys551, Ser555, Lys576, Lys597, Lys598, Lys664, Lys670, Lys686 and Ser717. MAPT is Polyubiquitinated.
Database Links Entrez Gene: 4137 Human, Omim: 157140 Human, SwissProt: P10636 Human, Unigene: 101174 Human

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MAPT antibody (70R-6020) | MAPT antibody (70R-6020) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors