MARCO antibody (70R-6455)

Rabbit polyclonal MARCO antibody raised against the N terminal of MARCO

Synonyms Polyclonal MARCO antibody, Anti-MARCO antibody, Macrophage Receptor With Collagenous Structure antibody, SCARA2 antibody
Specificity MARCO antibody was raised against the N terminal of MARCO
Cross Reactivity Human
Applications WB
Immunogen MARCO antibody was raised using the N terminal of MARCO corresponding to a region with amino acids QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
Assay Information MARCO Blocking Peptide, catalog no. 33R-7477, is also available for use as a blocking control in assays to test for specificity of this MARCO antibody


Western Blot analysis using MARCO antibody (70R-6455)

MARCO antibody (70R-6455) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MARCO antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MARCO antibody (70R-6455) | MARCO antibody (70R-6455) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors