MARVELD2 antibody (70R-6334)

Rabbit polyclonal MARVELD2 antibody raised against the middle region of MARVELD2

Synonyms Polyclonal MARVELD2 antibody, Anti-MARVELD2 antibody, MARVELD-2 antibody, Marvel Domain Containing 2 antibody, Tric antibody, MARVELD2, MARVD2 antibody, DFNB49 antibody, MARVELD 2, MRVLDC2 antibody, MARVELD-2, FLJ30532 antibody, MARVELD 2 antibody
Specificity MARVELD2 antibody was raised against the middle region of MARVELD2
Cross Reactivity Human, Mouse
Applications WB
Immunogen MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
Assay Information MARVELD2 Blocking Peptide, catalog no. 33R-7179, is also available for use as a blocking control in assays to test for specificity of this MARVELD2 antibody

Images

Western Blot analysis using MARVELD2 antibody (70R-6334)

MARVELD2 antibody (70R-6334) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MARVELD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MARVELD2 antibody (70R-6334) | MARVELD2 antibody (70R-6334) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors