MAS1 antibody (70R-1838)

Rabbit polyclonal MAS1 antibody raised against the middle region of MAS1

Synonyms Polyclonal MAS1 antibody, Anti-MAS1 antibody, MAS1, MAS-1, MAS 1, MAS 1 antibody, MAS antibody, Mas1 Oncogene antibody, MAS-1 antibody, MGC119966 antibody
Specificity MAS1 antibody was raised against the middle region of MAS1
Cross Reactivity Human
Applications IHC, WB
Immunogen MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
Assay Information MAS1 Blocking Peptide, catalog no. 33R-8095, is also available for use as a blocking control in assays to test for specificity of this MAS1 antibody


Immunohistochemical staining using MAS1 antibody (70R-1838)

MAS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MAS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MAS1 antibody (70R-1838) | MAS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MAS1 antibody (70R-1838) | MAS1 antibody (70R-1838) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using MAS1 antibody (70R-1838) | MAS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors