MASP2 antibody (70R-5919)

Rabbit polyclonal MASP2 antibody raised against the N terminal of MASP2

Synonyms Polyclonal MASP2 antibody, Anti-MASP2 antibody, sMAP antibody, MAP19 antibody, MASP 2 antibody, MASP-2, MASP-2 antibody, MASP2, MASP-2 antibody, MASP 2, Mannan-Binding Lectin Serine Peptidase 2 antibody
Specificity MASP2 antibody was raised against the N terminal of MASP2
Cross Reactivity Human,Mouse
Applications WB
Immunogen MASP2 antibody was raised using the N terminal of MASP2 corresponding to a region with amino acids FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
Assay Information MASP2 Blocking Peptide, catalog no. 33R-3017, is also available for use as a blocking control in assays to test for specificity of this MASP2 antibody

Images

Western Blot analysis using MASP2 antibody (70R-5919)

MASP2 antibody (70R-5919) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MASP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MASP2 antibody (70R-5919) | MASP2 antibody (70R-5919) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors