Matrin 3 antibody (70R-1390)

Rabbit polyclonal Matrin 3 antibody raised against the C terminal of MATR3

Synonyms Polyclonal Matrin 3 antibody, Anti-Matrin 3 antibody, DKFZp686K23100 antibody, Matrin 3, Matrin 3 antibody, DKFZp686K0542 antibody, MGC9105 antibody, KIAA0723 antibody, Matrin -3 antibody, MATR3 antibody, Matrin 3, Matrin -3
Specificity Matrin 3 antibody was raised against the C terminal of MATR3
Cross Reactivity Human,Mouse
Applications WB
Immunogen Matrin 3 antibody was raised using the C terminal of MATR3 corresponding to a region with amino acids ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG
Assay Information Matrin 3 Blocking Peptide, catalog no. 33R-1084, is also available for use as a blocking control in assays to test for specificity of this Matrin 3 antibody

Images

Western Blot analysis using Matrin 3 antibody (70R-1390)

Matrin 3 antibody (70R-1390) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MATR3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Matrin 3 antibody (70R-1390) | Matrin 3 antibody (70R-1390) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors