Matrin 3 Blocking Peptide (33R-1084)

A synthetic peptide for use as a blocking control in assays to test for specificity of MATR3 antibody, catalog no. 70R-1390

Synonyms Matrin 3 control peptide, Matrin 3 antibody Blocking Peptide, Anti-Matrin 3 Blocking Peptide, DKFZp686K0542 Blocking Peptide, DKFZp686K23100 Blocking Peptide, KIAA0723 Blocking Peptide, MGC9105 Blocking Peptide, MATR3 Blocking Peptide, Matrin 3, Matrin -3, Matrin 3, Matrin -3 Blocking Peptide, Matrin 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADDPNKDTSENADGQSDENKDDYTIPDEYRIGPYQPNVPVGIDYVIPKTG
Molecular Weight 94 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors