MBD2 antibody (70R-1031)

Rabbit polyclonal MBD2 antibody raised against the middle region of MBD2

Synonyms Polyclonal MBD2 antibody, Anti-MBD2 antibody, MBD-2, MBD 2 antibody, MBD 2, MBD-2 antibody, MBD2, Methyl-Cpg Binding Domain Protein 2 antibody
Specificity MBD2 antibody was raised against the middle region of MBD2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MBD2 antibody was raised using the middle region of MBD2 corresponding to a region with amino acids DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT
Assay Information MBD2 Blocking Peptide, catalog no. 33R-1873, is also available for use as a blocking control in assays to test for specificity of this MBD2 antibody

Images

Western blot analysis using MBD2 antibody (70R-1031)

Recommended MBD2 Antibody Titration: 0.625ug/ml

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MBD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.625 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MBD2 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD2 can also repress transcription from methylated gene promoters. MBD2 may function as a mediator of the biological consequences of the methylation signal. It is also reported that the MBD2 functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using MBD2 antibody (70R-1031) | Recommended MBD2 Antibody Titration: 0.625ug/ml
  • Western blot analysis using MBD2 antibody (70R-1031) | Human HEK293T lysate

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors