MBD3 antibody (70R-2026)

Rabbit polyclonal MBD3 antibody raised against the N terminal of MBD3

Synonyms Polyclonal MBD3 antibody, Anti-MBD3 antibody, MBD-3 antibody, MBD3, MBD 3, MBD-3, MBD 3 antibody, Methyl-Cpg Binding Domain Protein 3 antibody
Specificity MBD3 antibody was raised against the N terminal of MBD3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MBD3 antibody was raised using the N terminal of MBD3 corresponding to a region with amino acids SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN
Assay Information MBD3 Blocking Peptide, catalog no. 33R-8560, is also available for use as a blocking control in assays to test for specificity of this MBD3 antibody

Images

Western blot analysis using MBD3 antibody (70R-2026)

Recommended MBD3 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MBD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using MBD3 antibody (70R-2026) | Recommended MBD3 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors