MBNL1 antibody (70R-1551)

Rabbit polyclonal MBNL1 antibody

Synonyms Polyclonal MBNL1 antibody, Anti-MBNL1 antibody, MBNL-1 antibody, MBNL 1 antibody, Muscleblind-Like antibody, MBNL 1, MBNL-1, MBNL1
Cross Reactivity Human,Dog
Applications WB
Immunogen MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCPQQQHLPQVFPSLQQPQPTSPILDASTLLGATSCPAAAAGKMIPIISA
Assay Information MBNL1 Blocking Peptide, catalog no. 33R-4829, is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody


Western Blot analysis using MBNL1 antibody (70R-1551)

MBNL1 antibody (70R-1551) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MBNL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MBNL1 antibody (70R-1551) | MBNL1 antibody (70R-1551) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors