MCM3 antibody (70R-5514)

Rabbit polyclonal MCM3 antibody raised against the C terminal of MCM3

Synonyms Polyclonal MCM3 antibody, Anti-MCM3 antibody, HCC5 antibody, MCM3, MGC1157 antibody, MCM 3, MCM-3, MCM-3 antibody, P1-MCM3 antibody, Minichromosome Maintenance Complex Component 3 antibody, P1.h antibody, MCM 3 antibody, RLFB antibody
Specificity MCM3 antibody was raised against the C terminal of MCM3
Cross Reactivity Human
Applications WB
Immunogen MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK
Assay Information MCM3 Blocking Peptide, catalog no. 33R-10056, is also available for use as a blocking control in assays to test for specificity of this MCM3 antibody

Images

Western Blot analysis using MCM3 antibody (70R-5514)

MCM3 antibody (70R-5514) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCM3 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MCM3 antibody (70R-5514) | MCM3 antibody (70R-5514) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors