MCM4 antibody (70R-1600)

Rabbit polyclonal MCM4 antibody raised against the middle region of MCM4

Synonyms Polyclonal MCM4 antibody, Anti-MCM4 antibody, MCM 4 antibody, MCM 4, Minichromosome Maintenance Complex Component 4 antibody, MCM-4, MCM4, MCM-4 antibody
Specificity MCM4 antibody was raised against the middle region of MCM4
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen MCM4 antibody was raised using the middle region of MCM4 corresponding to a region with amino acids VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE
Assay Information MCM4 Blocking Peptide, catalog no. 33R-9921, is also available for use as a blocking control in assays to test for specificity of this MCM4 antibody

Western Blot analysis using MCM4 antibody (70R-1600)

MCM4 antibody (70R-1600) used at 1.25 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 95 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MCM4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by MCM4 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. The MCM4 gene is mapped to a region on the chromosome 8 head-to-head next to the PRkDaC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using MCM4 antibody (70R-1600) | MCM4 antibody (70R-1600) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors