MCM7 antibody (70R-5569)

Rabbit polyclonal MCM7 antibody raised against the middle region of MCM7

Synonyms Polyclonal MCM7 antibody, Anti-MCM7 antibody, P1.1-MCM3 antibody, MCM-7 antibody, CDC47 antibody, MCM7, Minichromosome Maintenance Complex Component 7 antibody, MCM-7, CDABP0042 antibody, MCM 7 antibody, P85MCM antibody, MCM 7, MCM2 antibody, PNAS-146 antibody, P1CDC47 antibody
Specificity MCM7 antibody was raised against the middle region of MCM7
Cross Reactivity Human
Applications WB
Immunogen MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI
Assay Information MCM7 Blocking Peptide, catalog no. 33R-5458, is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody


Western Blot analysis using MCM7 antibody (70R-5569)

MCM7 antibody (70R-5569) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCM7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MCM7 antibody (70R-5569) | MCM7 antibody (70R-5569) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors