MCM9 antibody (70R-5552)

Rabbit polyclonal MCM9 antibody raised against the N terminal of MCM9

Synonyms Polyclonal MCM9 antibody, Anti-MCM9 antibody, C6orf61 antibody, MCM-9 antibody, dJ329L24.3 antibody, FLJ13942 antibody, MCM-9, MCM9, dJ329L24.1 antibody, MCM 9, MCMDC1 antibody, MCM 9 antibody, MGC35304 antibody, Minichromosome Maintenance Complex Component 9 antibody, FLJ20170 antibody
Specificity MCM9 antibody was raised against the N terminal of MCM9
Cross Reactivity Human,Mouse
Applications WB
Immunogen MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
Assay Information MCM9 Blocking Peptide, catalog no. 33R-6870, is also available for use as a blocking control in assays to test for specificity of this MCM9 antibody

Images

Western Blot analysis using MCM9 antibody (70R-5552)

MCM9 antibody (70R-5552) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCM9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCM9 is a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MCM9 antibody (70R-5552) | MCM9 antibody (70R-5552) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors