MCTP1 antibody (70R-6811)

Rabbit polyclonal MCTP1 antibody raised against the middle region of MCTP1

Synonyms Polyclonal MCTP1 antibody, Anti-MCTP1 antibody, Multiple C2 Domains Transmembrane 1 antibody, MCTP1, MCTP 1, MCTP-1, MCTP-1 antibody, FLJ22344 antibody, MCTP 1 antibody
Specificity MCTP1 antibody was raised against the middle region of MCTP1
Cross Reactivity Human
Applications WB
Immunogen MCTP1 antibody was raised using the middle region of MCTP1 corresponding to a region with amino acids EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNKQLTGPTKGVIY
Assay Information MCTP1 Blocking Peptide, catalog no. 33R-2808, is also available for use as a blocking control in assays to test for specificity of this MCTP1 antibody

Images

Immunohistochemical staining using MCTP1 antibody (70R-6811)

MCTP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCTP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MCTP1 belongs to the MCTP family.It contains 3 C2 domains. MCTP1 is a multi-pass membrane protein. It binds calcium via the C2 domains in absence of phospholipids. The function of MCTP1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using MCTP1 antibody (70R-6811) | MCTP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using MCTP1 antibody (70R-6811) | MCTP1 antibody (70R-6811) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using MCTP1 antibody (70R-6811) | MCTP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors