MDH1B antibody (70R-3381)

Rabbit polyclonal MDH1B antibody

Synonyms Polyclonal MDH1B antibody, Anti-MDH1B antibody, FLJ25341 antibody, MDHB 1, MDH1B, MDHB-1 antibody, MDHB 1 antibody, MDHB-1, RP11-95H11 antibody, Malate Dehydrogenase 1B Nad antibody
Cross Reactivity Human
Applications WB
Immunogen MDH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids YQSGHKDLVPDEEKNLAMSDAAEFPNQIPQTTFEKPQSLEFLNEFEGKTV
Assay Information MDH1B Blocking Peptide, catalog no. 33R-10218, is also available for use as a blocking control in assays to test for specificity of this MDH1B antibody


Western Blot analysis using MDH1B antibody (70R-3381)

MDH1B antibody (70R-3381) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MDH1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MDH1B protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MDH1B antibody (70R-3381) | MDH1B antibody (70R-3381) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors