MDH2 antibody (70R-1090)

Rabbit polyclonal MDH2 antibody

Synonyms Polyclonal MDH2 antibody, Anti-MDH2 antibody, MDH2, MDH 2 antibody, MOR1 antibody, M-MDH antibody, MDH-2, MDH-2 antibody, Malate Dehydrogenase 2 Nad antibody, MDH 2, MGC:3559 antibody, MDH antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen MDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK
Assay Information MDH2 Blocking Peptide, catalog no. 33R-9388, is also available for use as a blocking control in assays to test for specificity of this MDH2 antibody

Images

Western Blot analysis using MDH2 antibody (70R-1090)

MDH2 antibody (70R-1090) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MDH2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MDH2 antibody (70R-1090) | MDH2 antibody (70R-1090) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors