MDP1 antibody (70R-3521)

Rabbit polyclonal MDP-1 antibody raised against the N terminal Of Mdp-1

Synonyms Polyclonal MDP1 antibody, Anti-MDP1 antibody, Fructosamine-6-phosphatase antibody, MDP1, FN6Pase antibody, MDP-1 antibody, MGC5987 antibody, MDP-1 antibody, Magnesium dependent phosphatase 1 antibody, MDP 1, MDP 1 antibody, MDP-1
Specificity MDP1 antibody was raised against the N terminal Of Mdp-1
Cross Reactivity Human
Applications WB
Immunogen MDP1 antibody was raised using the N terminal Of Mdp-1 corresponding to a region with amino acids MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE
Assay Information MDP1 Blocking Peptide, catalog no. 33R-5731, is also available for use as a blocking control in assays to test for specificity of this MDP1 antibody


Western Blot analysis using MDP1 antibody (70R-3521)

MDP1 antibody (70R-3521) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MDP-1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MDP1 antibody (70R-3521) | MDP1 antibody (70R-3521) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors