ME2 antibody (70R-2512)

Rabbit polyclonal ME2 antibody

Synonyms Polyclonal ME2 antibody, Anti-ME2 antibody, Malic Enzyme 2 Nad antibody, ME-2, ME 2, ME2, ME 2 antibody, ME-2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ME2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG
Assay Information ME2 Blocking Peptide, catalog no. 33R-5654, is also available for use as a blocking control in assays to test for specificity of this ME2 antibody


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ME2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ME2 is a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors