ME3 antibody (70R-2502)

Rabbit polyclonal ME3 antibody

Synonyms Polyclonal ME3 antibody, Anti-ME3 antibody, ME 3 antibody, ME 3, ME3, FLJ34862 antibody, ME-3, Malic Enzyme 3 Nadp antibody, ME-3 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen ME3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD
Assay Information ME3 Blocking Peptide, catalog no. 33R-7120, is also available for use as a blocking control in assays to test for specificity of this ME3 antibody


Western Blot analysis using ME3 antibody (70R-2502)

ME3 antibody (70R-2502) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ME3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. ME3 is a mitochondrial NADP(+)-dependent isoform.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ME3 antibody (70R-2502) | ME3 antibody (70R-2502) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors