MED8 antibody (70R-3778)

Rabbit polyclonal MED8 antibody raised against the N terminal of MED8

Synonyms Polyclonal MED8 antibody, Anti-MED8 antibody, MED 8, Mediator Complex Subunit 8 antibody, MED 8 antibody, MGC17544 antibody, MGC19641 antibody, MED-8 antibody, MED-8, ARC32 antibody, MED8
Specificity MED8 antibody was raised against the N terminal of MED8
Cross Reactivity Human,Mouse
Applications WB
Immunogen MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFA
Assay Information MED8 Blocking Peptide, catalog no. 33R-6339, is also available for use as a blocking control in assays to test for specificity of this MED8 antibody


Western Blot analysis using MED8 antibody (70R-3778)

MED8 antibody (70R-3778) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MED8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MED8 is a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. MED8 also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MED8 antibody (70R-3778) | MED8 antibody (70R-3778) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors