MELK antibody (70R-3472)

Rabbit polyclonal MELK antibody raised against the middle region of MELK

Synonyms Polyclonal MELK antibody, Anti-MELK antibody, KIAA0175 antibody, HPK38 antibody, Maternal Embryonic Leucine Zipper Kinase antibody
Specificity MELK antibody was raised against the middle region of MELK
Cross Reactivity Human
Applications WB
Immunogen MELK antibody was raised using the middle region of MELK corresponding to a region with amino acids AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK
Assay Information MELK Blocking Peptide, catalog no. 33R-1602, is also available for use as a blocking control in assays to test for specificity of this MELK antibody


Western Blot analysis using MELK antibody (70R-3472)

MELK antibody (70R-3472) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MELK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein MELK phosphorylates ZNF622 and may contribute to its redirection to the nucleus. Also it may be involved in the inhibition of spliceosome assembly during mitosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MELK antibody (70R-3472) | MELK antibody (70R-3472) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors