Mesothelin antibody (70R-6186)

Rabbit polyclonal Mesothelin antibody raised against the middle region of MSLN

Synonyms Polyclonal Mesothelin antibody, Anti-Mesothelin antibody, MSLN antibody, CAK1 antibody, SMR antibody, MPF antibody
Specificity Mesothelin antibody was raised against the middle region of MSLN
Cross Reactivity Human
Applications WB
Immunogen Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKGRGQLDKDTLDTLTAF
Assay Information Mesothelin Blocking Peptide, catalog no. 33R-5073, is also available for use as a blocking control in assays to test for specificity of this Mesothelin antibody


Western Blot analysis using Mesothelin antibody (70R-6186)

Mesothelin antibody (70R-6186) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MSLN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance An antibody that reacts with ovarian cancers and mesotheliomas was used to isolate a cell surface antigen named mesothelin. Although the function of mesothelin is unknown, it may play a role in cellular adhesion and is present on mesothelium and mesothelioma.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Mesothelin antibody (70R-6186) | Mesothelin antibody (70R-6186) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors