Metaxin 1 antibody (70R-6347)

Rabbit polyclonal Metaxin 1 antibody raised against the C terminal of MTX1

Synonyms Polyclonal Metaxin 1 antibody, Anti-Metaxin 1 antibody, Metaxin 1, Metaxin 1 antibody, Metaxin -1, Metaxin 1, MTX antibody, MTX1 antibody, Metaxin -1 antibody, MTXN antibody
Specificity Metaxin 1 antibody was raised against the C terminal of MTX1
Cross Reactivity Human,Mouse
Applications WB
Immunogen Metaxin 1 antibody was raised using the C terminal of MTX1 corresponding to a region with amino acids CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG
Assay Information Metaxin 1 Blocking Peptide, catalog no. 33R-1748, is also available for use as a blocking control in assays to test for specificity of this Metaxin 1 antibody

Images

Western Blot analysis using Metaxin 1 antibody (70R-6347)

Metaxin 1 antibody (70R-6347) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MTX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MTX1 belongs to the metaxin family. It is involved in transport of proteins into the mitochondrion and essential for embryonic development.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Metaxin 1 antibody (70R-6347) | Metaxin 1 antibody (70R-6347) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors