MFAP3L antibody (70R-1726)

Rabbit polyclonal MFAP3L antibody raised against the N terminal of MFAP3L

Synonyms Polyclonal MFAP3L antibody, Anti-MFAP3L antibody, MFAPL-3, MFAPL 3, MFAPL 3 antibody, MFAP3L, MFAPL-3 antibody, Microfibrillar-Associated Protein 3-Like antibody, NYD-sp9 antibody
Specificity MFAP3L antibody was raised against the N terminal of MFAP3L
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY
Assay Information MFAP3L Blocking Peptide, catalog no. 33R-6090, is also available for use as a blocking control in assays to test for specificity of this MFAP3L antibody


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MFAP3L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MFAP3L protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors