MFAP4 antibody (70R-6069)

Rabbit polyclonal MFAP4 antibody raised against the N terminal of MFAP4

Synonyms Polyclonal MFAP4 antibody, Anti-MFAP4 antibody, Microfibrillar-Associated Protein 4 antibody, MFAP-4 antibody, MFAP 4 antibody, MFAP 4, MFAP4, MFAP-4
Specificity MFAP4 antibody was raised against the N terminal of MFAP4
Cross Reactivity Human,Rat
Applications WB
Immunogen MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK
Assay Information MFAP4 Blocking Peptide, catalog no. 33R-9037, is also available for use as a blocking control in assays to test for specificity of this MFAP4 antibody

Images

Western Blot analysis using MFAP4 antibody (70R-6069)

MFAP4 antibody (70R-6069) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFAP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MFAP4 antibody (70R-6069) | MFAP4 antibody (70R-6069) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors