MFNG antibody (70R-5292)

Rabbit polyclonal MFNG antibody raised against the C terminal of MFNG

Synonyms Polyclonal MFNG antibody, Anti-MFNG antibody, Mfng O-Fucosylpeptide 3-Beta-N-Acetylglucosaminyltransferase antibody
Specificity MFNG antibody was raised against the C terminal of MFNG
Cross Reactivity Human
Applications WB
Immunogen MFNG antibody was raised using the C terminal of MFNG corresponding to a region with amino acids QLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYP
Assay Information MFNG Blocking Peptide, catalog no. 33R-7632, is also available for use as a blocking control in assays to test for specificity of this MFNG antibody


Western Blot analysis using MFNG antibody (70R-5292)

MFNG antibody (70R-5292) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFNG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MFNG antibody (70R-5292) | MFNG antibody (70R-5292) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors