MFRP antibody (70R-6525)

Rabbit polyclonal MFRP antibody raised against the N terminal of MFRP

Synonyms Polyclonal MFRP antibody, Anti-MFRP antibody, FLJ30570 antibody, NNO2 antibody, rd6 antibody, Membrane Frizzled-Related Protein antibody
Specificity MFRP antibody was raised against the N terminal of MFRP
Cross Reactivity Human
Applications WB
Immunogen MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE
Assay Information MFRP Blocking Peptide, catalog no. 33R-8996, is also available for use as a blocking control in assays to test for specificity of this MFRP antibody

Images

Western Blot analysis using MFRP antibody (70R-6525)

MFRP antibody (70R-6525) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFRP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MFRP antibody (70R-6525) | MFRP antibody (70R-6525) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors