MFSD1 antibody (70R-6533)

Rabbit polyclonal MFSD1 antibody raised against the middle region of MFSD1

Synonyms Polyclonal MFSD1 antibody, Anti-MFSD1 antibody, MFSD-1 antibody, MFSD 1, Major Facilitator Superfamily Domain Containing 1 antibody, MFSD 1 antibody, MFSD1, UG0581B09 antibody, FLJ14153 antibody, MFSD-1
Specificity MFSD1 antibody was raised against the middle region of MFSD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MFSD1 antibody was raised using the middle region of MFSD1 corresponding to a region with amino acids RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM
Assay Information MFSD1 Blocking Peptide, catalog no. 33R-7910, is also available for use as a blocking control in assays to test for specificity of this MFSD1 antibody

Images

Western Blot analysis using MFSD1 antibody (70R-6533)

MFSD1 antibody (70R-6533) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFSD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MFSD1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MFSD1 antibody (70R-6533) | MFSD1 antibody (70R-6533) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors