MGAT2 antibody (70R-7297)

Rabbit polyclonal MGAT2 antibody

Synonyms Polyclonal MGAT2 antibody, Anti-MGAT2 antibody, GNT2 antibody, GNT-II antibody, MGAT-2 antibody, MGAT 2, Alpha 1-6-Glycoprotein Beta-1-2-N-Acetylglucosaminyltransferase antibody, MGAT2, MGAT-2, MGAT 2 antibody, Mannosyl antibody, GLCNACTII antibody, CDGS2 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF
Assay Information MGAT2 Blocking Peptide, catalog no. 33R-10048, is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody

Images

Western Blot analysis using MGAT2 antibody (70R-7297)

MGAT2 antibody (70R-7297) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGAT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGAT2 antibody (70R-7297) | MGAT2 antibody (70R-7297) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors