MGC16169 antibody (70R-3259)

Rabbit polyclonal MGC16169 antibody raised against the middle region of Mgc16169

Synonyms Polyclonal MGC16169 antibody, Anti-MGC16169 antibody, MGC 16169 antibody, MGC16169, MGC-16169, MGC-16169 antibody, MGC 16169, HSPC302 antibody
Specificity MGC16169 antibody was raised against the middle region of Mgc16169
Cross Reactivity Human
Applications WB
Immunogen MGC16169 antibody was raised using the middle region of Mgc16169 corresponding to a region with amino acids PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA
Assay Information MGC16169 Blocking Peptide, catalog no. 33R-7258, is also available for use as a blocking control in assays to test for specificity of this MGC16169 antibody

Images

Western Blot analysis using MGC16169 antibody (70R-3259)

MGC16169 antibody (70R-3259) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC16169 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC16169 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC16169 antibody (70R-3259) | MGC16169 antibody (70R-3259) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors