MGC26647 antibody (70R-4251)

Rabbit polyclonal MGC26647 antibody raised against the N terminal of MGC26647

Synonyms Polyclonal MGC26647 antibody, Anti-MGC26647 antibody, Hypothetical Protein Mgc26647 antibody, MGC-26647, MGC-26647 antibody, MGC 26647 antibody, MGC26647, MGC 26647
Specificity MGC26647 antibody was raised against the N terminal of MGC26647
Cross Reactivity Human
Applications WB
Immunogen MGC26647 antibody was raised using the N terminal of MGC26647 corresponding to a region with amino acids EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA
Assay Information MGC26647 Blocking Peptide, catalog no. 33R-2369, is also available for use as a blocking control in assays to test for specificity of this MGC26647 antibody

Images

Western Blot analysis using MGC26647 antibody (70R-4251)

MGC26647 antibody (70R-4251) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC26647 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC26647 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC26647 antibody (70R-4251) | MGC26647 antibody (70R-4251) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors