MGC33407 antibody (70R-4401)

Rabbit polyclonal MGC33407 antibody raised against the middle region of MGC33407

Synonyms Polyclonal MGC33407 antibody, Anti-MGC33407 antibody, HSD21 antibody, MGC 33407 antibody, Hypothetical Protein Mgc33407 antibody, MGC-33407 antibody, MGC33407, MGC-33407, MGC 33407
Specificity MGC33407 antibody was raised against the middle region of MGC33407
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MGC33407 antibody was raised using the middle region of MGC33407 corresponding to a region with amino acids DHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVS
Assay Information MGC33407 Blocking Peptide, catalog no. 33R-1981, is also available for use as a blocking control in assays to test for specificity of this MGC33407 antibody

Images

Western Blot analysis using MGC33407 antibody (70R-4401)

MGC33407 antibody (70R-4401) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC33407 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC33407 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC33407 antibody (70R-4401) | MGC33407 antibody (70R-4401) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors