MGC34821 antibody (70R-4292)

Rabbit polyclonal MGC34821 antibody raised against the middle region of Mgc34821

Synonyms Polyclonal MGC34821 antibody, Anti-MGC34821 antibody, MGC-34821, MGC 34821, NET46 antibody, SLC22A24 antibody, MGC34821, MGC-34821 antibody, MGC 34821 antibody
Specificity MGC34821 antibody was raised against the middle region of Mgc34821
Cross Reactivity Human
Applications WB
Immunogen MGC34821 antibody was raised using the middle region of Mgc34821 corresponding to a region with amino acids VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF
Assay Information MGC34821 Blocking Peptide, catalog no. 33R-9535, is also available for use as a blocking control in assays to test for specificity of this MGC34821 antibody

Images

Western Blot analysis using MGC34821 antibody (70R-4292)

MGC34821 antibody (70R-4292) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC34821 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC34821 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC34821 antibody (70R-4292) | MGC34821 antibody (70R-4292) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors