MGC39633 antibody (70R-1737)

Rabbit polyclonal MGC39633 antibody raised against the N terminal Of Mgc39633

Synonyms Polyclonal MGC39633 antibody, Anti-MGC39633 antibody, MGC-39633, MGC 39633 antibody, MGC39633, MGC-39633 antibody, MGC 39633, MBC1 antibody, MGC39633 antibody
Specificity MGC39633 antibody was raised against the N terminal Of Mgc39633
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen MGC39633 antibody was raised using the N terminal Of Mgc39633 corresponding to a region with amino acids VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE
Assay Information MGC39633 Blocking Peptide, catalog no. 33R-9790, is also available for use as a blocking control in assays to test for specificity of this MGC39633 antibody


Immunohistochemical staining using MGC39633 antibody (70R-1737)

MGC39633 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MGC39633 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC39633 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using MGC39633 antibody (70R-1737) | MGC39633 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using MGC39633 antibody (70R-1737) | MGC39633 antibody (70R-1737) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors