MGC4172 antibody (70R-6909)

Rabbit polyclonal MGC4172 antibody raised against the middle region of MGC4172

Synonyms Polyclonal MGC4172 antibody, Anti-MGC4172 antibody, ARPG836 antibody, MGC 4172 antibody, MGC4172, Short-Chain Dehydrogenase/Reductase antibody, MGC-4172, MGC-4172 antibody, MGC 4172, FLJ39232 antibody
Specificity MGC4172 antibody was raised against the middle region of MGC4172
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MGC4172 antibody was raised using the middle region of MGC4172 corresponding to a region with amino acids DGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIR
Assay Information MGC4172 Blocking Peptide, catalog no. 33R-1951, is also available for use as a blocking control in assays to test for specificity of this MGC4172 antibody

Images

Western Blot analysis using MGC4172 antibody (70R-6909)

MGC4172 antibody (70R-6909) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC4172 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC4172 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using MGC4172 antibody (70R-6909) | MGC4172 antibody (70R-6909) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors