MGC4172 antibody (70R-6992)

Rabbit polyclonal MGC4172 antibody raised against the C terminal of MGC4172

Synonyms Polyclonal MGC4172 antibody, Anti-MGC4172 antibody, FLJ39232 antibody, MGC 4172, MGC4172, Short-Chain Dehydrogenase/Reductase antibody, MGC 4172 antibody, MGC-4172, ARPG836 antibody, MGC-4172 antibody
Specificity MGC4172 antibody was raised against the C terminal of MGC4172
Cross Reactivity Human,Mouse
Applications WB
Immunogen MGC4172 antibody was raised using the C terminal of MGC4172 corresponding to a region with amino acids VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD
Assay Information MGC4172 Blocking Peptide, catalog no. 33R-9515, is also available for use as a blocking control in assays to test for specificity of this MGC4172 antibody


Western Blot analysis using MGC4172 antibody (70R-6992)

MGC4172 antibody (70R-6992) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC4172 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance MGC4172 possesses oxidoreductase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MGC4172 antibody (70R-6992) | MGC4172 antibody (70R-6992) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors