MGC42105 antibody (70R-4189)

Rabbit polyclonal MGC42105 antibody raised against the middle region of MGC42105

Synonyms Polyclonal MGC42105 antibody, Anti-MGC42105 antibody, MGC 42105 antibody, MGC 42105, MGC-42105 antibody, Hypothetical Protein Mgc42105 antibody, MGC42105, MGC-42105
Specificity MGC42105 antibody was raised against the middle region of MGC42105
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen MGC42105 antibody was raised using the middle region of MGC42105 corresponding to a region with amino acids LSKLHLVMEYAGGGELFGKISTEGKLSEPESKLIFSQIVSAVKHMHENQI
Assay Information MGC42105 Blocking Peptide, catalog no. 33R-5434, is also available for use as a blocking control in assays to test for specificity of this MGC42105 antibody


Western Blot analysis using MGC42105 antibody (70R-4189)

MGC42105 antibody (70R-4189) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MGC42105 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of MGC42105 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using MGC42105 antibody (70R-4189) | MGC42105 antibody (70R-4189) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors